The genome of a female Hereford cow was published in 2009. It was sequenced by the BovineGenome Sequencing and Analysis Consortium, a team of researchers...
Bovine Metabolome Database is a free web database about metabolites information of bovine (cow). It collects 7859 metabolites totally. Each metabolite...
major MODs--FlyBase, Saccharomyces GenomeDatabase, Mouse GenomeDatabase, and at or run off a Chado schema database. The Chado schema aims to cover many...
genomic database for the legume family Personal Genome Project: human genomes of 100,000 volunteers from around the world RGD (Rat GenomeDatabase): genomic...
Hanukoglu I (November 1993). "Mitochondrial-genome-encoded RNAs: differential regulation by corticotropin in bovine adrenocortical cells". Proceedings of the...
Health and the US Department of Agriculture reported having mapped the bovinegenome. Cattle have some 22,000 genes, of which 80% are shared with humans;...
aerobic bacterium and the causative agent of tuberculosis in cattle (known as bovine TB). It is related to Mycobacterium tuberculosis, the bacterium which causes...
editing and the latest improvement in bovine reproduction technologies (e.g. in vitro embryo culture) allows for genome editing directly in fertilised oocytes...
Comparative genomics is a branch of biological research that examines genome sequences across a spectrum of species, spanning from humans and mice to a...
viruses with a positive-sense single-stranded RNA genome and a nucleocapsid of helical symmetry. The genome size of coronaviruses ranges from approximately...
Bovine leukemia virus (BLV) is a retrovirus which causes enzootic bovine leukosis in cattle. It is closely related to the human T‑lymphotropic virus type...
non-FMDV serotypes belonging to three additional species Bovine rhinitis A virus (BRAV), Bovine rhinitis B virus (BRBV) and Equine rhinitis A virus (ERAV)...
characters in length. For example: >MCHU - Calmodulin - Human, rabbit, bovine, rat, and chicken MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID...
Fisher LW, Kolodny N, Termine JD, Young MF (August 1991). "Sequencing of bovine enamelin ("tuftelin") a novel acidic enamel protein". J. Biol. Chem. 266...
Bovine viral diarrhea (BVD), bovine viral diarrhoea (UK English) or mucosal disease, previously referred to as bovine virus diarrhea (BVD), is an economically...
protein-level annotation is to assign function to the protein products of the genome. Databases of protein sequences and functional domains and motifs are used for...
Flaviviridae Genomesdatabase search results from the Viral Bioinformatics Resource Center Viralzone: Flaviviridae Virus Pathogen Database and Analysis...
Several genome-wide secretome databases or knowledgebases are available based on both curation and computational prediction. These databases include the...
Sequence Database Collaboration, a public database which can be searched on the web. A few of the listed genomes may not be in the INSDC database, but in...
S2CID 8466307. Ureaplasma Infection at eMedicine Ureaplasma Genome Projects from Genomes OnLine Database Type strain of Ureaplasma urealyticum at BacDive – the...
China in 2014. Genome length of porcine Torovirus was found to be 28301 bp and possess 79% sequence identity with the bovine Torovirus genome. Cattle, pig...
based on nuclear genomes after Sinding, et al. 2021. The gaur is the largest extant bovid. It is a strong and massively built bovine with a high convex...
population. The genome for F. hepatica was published in 2015. At 1.3 Gb, its genome is one of the largest known pathogen genomes. The genome contains many...
Global Information